PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_11992A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family Nin-like
Protein Properties Length: 937aa    MW: 102100 Da    PI: 5.8633
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_11992AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK85.74e-27565615252
                     RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                                ek+ sl++l+kyFs++++dAA +Lgvc+T+LKriCRq+GI+RWP+Rki+++
  Oropetium_20150105_11992A 565 EKNFSLDVLRKYFSGSLRDAAASLGVCPTTLKRICRQHGISRWPSRKINKV 615
                                899**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF557812.59E-5210284IPR029016GAF domain-like
Gene3DG3DSA:3.30.450.406.0E-4210290IPR029016GAF domain-like
PROSITE profilePS5151916.586554635IPR003035RWP-RK domain
PfamPF020421.2E-24568615IPR003035RWP-RK domain
SuperFamilySSF542771.35E-24828917No hitNo description
Gene3DG3DSA:3.10.20.2407.7E-23831913No hitNo description
PROSITE profilePS5174524.992834916IPR000270PB1 domain
SMARTSM006661.0E-21834916IPR000270PB1 domain
PfamPF005644.8E-17835915IPR000270PB1 domain
CDDcd064074.03E-30835915No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 937 aa     Download sequence    Send to blast
MDVPAPSNRA GCNGTISSPM GSSDDPFGAV MMSFDGYSEL CSPSVADQLF SLLNDPSATQ  60
QMFAMWSGSS PRASGMNQDI LFDACSGPME TAAAPTQKIN LASPMNTTEA NRGVKDSDEI  120
VPNNGQLQGS NIIPRPVVGN LLADKMLMAL SLFRKSLSDG VLAQVWMPVE HNGQLLLSTR  180
EQPYLLDQVL AGYREVSRHF LFSVKEEPGL HLGLPGRVFI SGVPEWTSNV LYYSKPEYLR  240
MDHALHHKIR GSLAMPIYDP SKGSCCAVLE LVTNKEKPDF DAEMDSVCHA LQAVNLLTTI  300
DRSSQKAYSE NQKSAFTEIL DVLRAICHAH MLPLALTWVP ASNGIDNGCA VGMDPGIDSE  360
LGKAILHIHE SACYVNDAKM QGFLHACAER HLDKGQGIAG RALKSNLPFF SPDIREYTIE  420
DYPLAHHARK FGLHAAVAIR LRSTYTGSDD YILEFFLPVN CKGSGEQQML LNNLSTTMQK  480
ICKSLRTVSE AEVDSVSPCS AEIYNNTNDC LLPTSNSDSS SHDDQPVTES TFQDLSLVDK  540
HGDMEPEQAH TSAMRVPDKK RSTSEKNFSL DVLRKYFSGS LRDAAASLGV CPTTLKRICR  600
QHGISRWPSR KINKVNRSLK KIQTVINSVH GVDRSLQYDP ATGSLVPAVS TLPDKMPFSS  660
CDTLLSPSVG KTAERKSNEK SEQGFSSPDG WQREELQVSS APKLEGDIFQ VLASDNNGDH  720
VANGTQNSTN SEGVQGPVYP ISAVHSLHTR ETGYIDSSTL LHPSIDGIKD DQTTRRNSSF  780
VQQADVDMAD GHDAKEHTNP STSGMTDSSS GSASSQPTFK GNPRHALKDR TSPALTVKAT  840
YNGDTVRFKF LPSTGWYNLL EEIAKRFKLA AGTFQLKYKD DEDEWVILAT DSDLQECIDV  900
LDSIGSRNVK LQVRDLPCLV SSSGSSSCLQ VEAHSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008661302.10.0PREDICTED: uncharacterized protein LOC100191188 isoform X1
SwissprotQ0JC270.0NLP2_ORYSJ; Protein NLP2
TrEMBLK7TLL40.0K7TLL4_MAIZE; Uncharacterized protein
STRINGGRMZM2G105004_P010.0(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36703573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G59580.20.0Nin-like family protein